(data stored in ACNUC7421 zone)

EMBL: CP001402.PE353

CP001402.PE353       Location/Qualifiers
FT   CDS_pept        complement(307260..307673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0359"
FT                   /product="protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40989"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL24"
FT                   /protein_id="ACR40989.1"
FT                   /translation="MKVYFEDIRVSTTRQFELVDITDQVEEIVGKSGVKNGICLIFVAH
FT                   STAAIVANEHERGLMEDILTKIKEFTEPSRGWKHNLIDDNAHAHLGATFLGAERVFPVR
FT                   DGKLVRGTWQNIFLVELDGPRSERHITVEILGE"
     atgaaggtgt acttcgagga tatacgcgtc tctacaacaa gacagtttga attagttgac        60
     attactgacc aagttgagga aattgtaggg aagagcggtg taaagaatgg aatctgtcta       120
     atttttgtag cacattcaac tgcagctata gtcgctaatg aacacgaaag aggactaatg       180
     gaagacattt taactaagat aaaggagttc acggaacctt cacgaggctg gaaacataat       240
     ctaattgatg ataacgcaca cgcccatcta ggtgcaactt tcctaggtgc ggaaagagtg       300
     ttcccagtta gagatggtaa attagttaga ggaacgtggc aaaatatatt cctagttgag       360
     ttagatggac ctaggagcga gagacatatc acagttgaga tcttaggaga gtag             414
//

If you have problems or comments...

PBIL Back to PBIL home page