(data stored in ACNUC7421 zone)

EMBL: CP001402.PE354

CP001402.PE354       Location/Qualifiers
FT   CDS_pept        307715..307852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40990"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL25"
FT                   /protein_id="ACR40990.1"
FT                   /translation="MREISIEWSGKILVLSDIHYPHCDIEEINKIMLSEKPSHTILLGV
FT                   "
     ttgagagaga tttccattga atggagtggt aagatactgg tgctatctga tattcattat        60
     ccccattgtg atattgaaga gataaacaaa ataatgctat ccgagaagcc ttcccatacg       120
     atccttttag gggtataa                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page