(data stored in ACNUC7421 zone)

EMBL: CP001402.PE355

CP001402.PE355       Location/Qualifiers
FT   CDS_pept        308343..309137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0361"
FT                   /product="transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40991"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL26"
FT                   /protein_id="ACR40991.1"
FT                   /translation="MDFIISDGGKVFLFSFLFATTMTRYKLSAEVSFSRPSEVMGKLYM
FT                   IPYKDNGQKVLYFDIDYPSFCKVSVNQDRFRNEYLSFDCNPSGYFSISINYEVEIYSFS
FT                   KFENEENVFLSSSKYVNIDKFRRFNIPYSSLDDLLNKITSFVRGSIKYDKNNSSVKSAF
FT                   GSLIMGSGVCVNYSHVTLGILRALGIPARYVVGLIPYSTKEAHAWVEVKVNDVWFPVDP
FT                   TNATKGIQYLKWAIGRDDADVRSKIWYRKPTSFDFSFNWYFR"
     atggacttta tcatttcaga tggtggtaaa gtttttcttt tttctttctt atttgcaacg        60
     acaatgacta gatataagct atccgctgaa gtttcctttt ctaggcctag tgaagtaatg       120
     ggcaagcttt atatgattcc ttataaggac aatgggcaaa aggtccttta ttttgatatc       180
     gattatccct cattttgcaa ggttagtgta aatcaagata gatttagaaa tgagtattta       240
     tcctttgact gtaatccctc tggctatttt tcaattagta tcaattatga ggtcgaaatt       300
     tattctttct caaaatttga gaatgaggag aatgtttttc tctcttcaag caaatatgtc       360
     aatattgata agtttaggag gtttaacata ccatattcct cacttgatga cctcctaaat       420
     aaaattacga gttttgttag gggtagtatt aagtacgata aaaacaatag tagcgttaaa       480
     tcggcatttg gctccttaat tatgggttct ggagtttgtg taaactatag ccacgttaca       540
     ctaggaattc taagagcatt gggaattcct gctagatacg ttgtgggttt aattccatat       600
     tctactaagg aagctcacgc atgggttgag gttaaggtta acgatgtgtg gtttcctgtt       660
     gatcccacta atgccactaa aggaatacag tatttgaaat gggctattgg gagagatgac       720
     gctgatgtta ggagtaagat ctggtatcgc aaacccacaa gttttgactt ctcttttaac       780
     tggtatttca gataa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page