(data stored in ACNUC7421 zone)

EMBL: CP001402.PE356

CP001402.PE356       Location/Qualifiers
FT   CDS_pept        309352..309711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40992"
FT                   /db_xref="InterPro:IPR009321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL27"
FT                   /protein_id="ACR40992.1"
FT                   /translation="MDESPLFEWEWISDPLDCPPDERCSPELMVGTMIPLEGNHRPFRV
FT                   GMNQSQYQLAILSATILGTNYSTNSITPNQLSLGYNAIKIDFKTSFTFVSGNIYVIQLT
FT                   LSNGQTLNISVVYQP"
     atggatgaaa gtcccctatt cgaatgggag tggatctctg atccactcga ctgcccacca        60
     gatgagagat gtagtcccga attgatggtg ggaacgatga tccctcttga ggggaaccat       120
     cgccctttca gggtggggat gaatcagtct caatatcagc tagcaatttt aagtgctaca       180
     atattaggta ctaattattc aacgaatagt attacgccta atcagctttc tttaggctat       240
     aacgctatta aaatcgattt caaaacttca ttcacttttg tatctggtaa catttacgtt       300
     atacaactaa ctttatcaaa tggacaaact ttaaacatta gtgtggtata tcagccttaa       360
//

If you have problems or comments...

PBIL Back to PBIL home page