(data stored in ACNUC7421 zone)

EMBL: CP001402.PE358

CP001402.PE358       Location/Qualifiers
FT   CDS_pept        complement(310467..311483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0364"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40994"
FT                   /db_xref="GOA:C4KL29"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL29"
FT                   /protein_id="ACR40994.1"
FT                   /translation="MVEKEMEEKVYKSIIKTIKDTPLEEFYTSGHRTCQGCESALVMRF
FT                   LAKAAGQRTIVIGATGCMYVANTTYYSTSWIVPWVHTQLGGSGAAALGTAAALRALMRK
FT                   GKIKQEPINVIAFCGDLGCADMGLSGVSNAMTYDYNLLIVLYDNESSANTDIQETSMTP
FT                   YGAQTSFSRPGKQRRIMKKRWKKSVVPMIIAGHRNIRYAATMTPAYPLDSINKIKKALA
FT                   IGGPTFIHSLDPCPKGWDYDPRFSHELGVLAAETGLWPLYEYIDGEIAYNEPTKSIVEG
FT                   RMKRKPVKEYLEKQGRFSHFTEEDIEHIQRMVDEMYEEWEIPGVMPIKSLNVKISDK"
     atggttgaaa aggaaatgga agaaaaggtg tataagtcaa ttattaagac aataaaagat        60
     acaccactgg aagagttcta tacatctggc cataggactt gtcaaggatg tgagtcagca       120
     ctagtcatga ggtttttggc taaagctgcc ggacaaagga ccatagttat aggagctact       180
     ggatgcatgt atgtggcaaa tactacatat tatagcacgt catggatagt accatgggtt       240
     cacacgcaat tgggaggatc tggtgcagct gcattaggta cagccgcagc attgagagca       300
     ttaatgagga aaggaaaaat aaagcaagaa cctataaacg tgatagcctt ctgtggagat       360
     ctaggatgtg cagatatggg tttgtctgga gtttcaaacg caatgacgta tgactataac       420
     ttactcatag tactttatga taatgaatct tcagctaaca ctgatattca agagactagc       480
     atgacacctt atggagcaca gacctcattc agtaggccag gtaagcaaag aaggataatg       540
     aagaagaggt ggaagaagag tgtagtccca atgataatag cagggcatag gaacattaga       600
     tacgccgcta ccatgacccc cgcctatcca ctggattcaa taaacaagat caagaaggca       660
     ttagcaatag gagggccaac tttcattcat tccttagatc catgtccaaa gggatgggat       720
     tatgatccaa ggttctctca tgaactggga gtattggcag ctgaaactgg actatggcca       780
     ctatatgagt atattgatgg ggagatagcg tacaatgagc ccacaaagag tatagtggag       840
     ggtagaatga agagaaaacc ggtaaaagag tacttagaaa agcaaggaag attctcacac       900
     tttacagagg aagacatcga gcacatacaa aggatggttg acgagatgta tgaagaatgg       960
     gaaatccccg gagtaatgcc aataaagtcg ttaaatgtaa agataagtga caaataa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page