(data stored in ACNUC7421 zone)

EMBL: CP001402.PE360

CP001402.PE360       Location/Qualifiers
FT   CDS_pept        complement(312746..313837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2843"
FT                   /product="pyruvate ferredoxin, flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2843"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40996"
FT                   /db_xref="GOA:C4KL31"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL31"
FT                   /protein_id="ACR40996.1"
FT                   /translation="MGVKDEVKYVEIVYRGIFQKRLAKYIAEGIVYTAREMGRPALSFG
FT                   RYGDSPERNGVPAKYYVGIGNGVNEEDLIGYSTRVEPDLVDTIIVLDDTLLKGVESWAW
FT                   QGVQPINLKLKSNGTMLVTSTKRINELLKMIPKKDFNWTLGVINTEPSFSGLWAFKDDL
FT                   TMEKVWGGLAKLRPDIIDLDHLIKYVSKKQDANKRISAVKEAYSSVDYRTVMKGEGIDF
FT                   VYNPPRLLTWQEMLEGTVIPAVPRGKRNELFKRGTTKFERPTVDFDTCIKCKLCWIYCP
FT                   DECFDETPDGYYDIAYDYCVGCGICADVCPVKDCIVMVDESMFTDYRRPYEMWKENKAK
FT                   YKEWLKNVRQARKERVYVPGLGR"
     atgggagtaa aagatgaagt gaagtatgta gagatagtat ataggggtat attccagaaa        60
     agattggcaa aatatattgc agaaggaatc gtgtatactg caagggaaat ggggagacca       120
     gccctatctt tcggaagata tggagattct ccagaaagga acggagtacc ggcgaaatac       180
     tatgttggaa taggaaatgg agtgaatgag gaagacctta tagggtactc aacaagagta       240
     gagcctgatc tagtagatac cattattgta ctagacgata ccctattaaa gggtgtagaa       300
     tcgtgggcat ggcaaggggt acaaccaatc aaccttaaac taaagagtaa cgggacaatg       360
     ctagtaacct ctacaaagag aattaacgaa ttgttgaaaa tgatacctaa aaaggacttc       420
     aattggactc taggagtaat aaatactgaa ccatcatttt cgggactatg ggcatttaag       480
     gatgatttaa caatggagaa agtctgggga ggattagcaa agttaagacc agatataatt       540
     gatttagatc atttaattaa atatgtaagt aaaaaacaag atgctaacaa gagaatatct       600
     gcggtcaagg aagcatattc gtcagtagat tacagaactg taatgaaagg tgagggaata       660
     gatttcgtat ataatccgcc tagactacta acatggcagg agatgttgga aggtacagta       720
     attcccgcag ttcctagagg aaagagaaac gaactcttta agagagggac tacgaaattt       780
     gagagaccta cagtagattt cgacacttgt atcaaatgta agttatgttg gatatactgt       840
     ccggatgaat gttttgatga gacgccagat ggatattacg atatagcata tgattactgt       900
     gtaggctgtg gcatatgcgc tgatgtatgt cccgttaagg attgcatagt aatggtagat       960
     gaatcgatgt tcacagatta cagaagacca tatgagatgt ggaaggagaa taaggcaaag      1020
     tacaaggaat ggttaaagaa tgtaaggcaa gctaggaaag aaagggtcta cgttccgggg      1080
     ttagggagat ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page