(data stored in ACNUC7421 zone)

EMBL: CP001402.PE363

CP001402.PE363       Location/Qualifiers
FT   CDS_pept        complement(317841..318194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0369"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40999"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL34"
FT                   /protein_id="ACR40999.1"
FT                   /translation="MTLLDTSVLIDIIKGKINNVGDSLSIISIMEVIRVLDKVKRLKVL
FT                   DQLKKTYTIYPLDEKVAIEYSELYYELREKGKLISDLDLIIASTAKAYNERLVTKDKDF
FT                   LSLSGYIEIKLIQ"
     atgaccttgc ttgatacctc agtcttaata gatataataa aaggtaaaat aaataatgtt        60
     ggtgattctc tttctataat ttctataatg gaagttatta gagttctgga taaggttaag       120
     aggttaaaag ttctagatca gttgaaaaag acctacacaa tatatccctt agacgaaaaa       180
     gtggcaatag agtattccga gctttattat gaattgaggg aaaagggtaa gttaatatct       240
     gacttagatt taataatagc ttctactgca aaggcttata acgaaaggct agtaactaaa       300
     gataaggact tcttatcatt aagcggttat atagagatta aactaattca ataa             354
//

If you have problems or comments...

PBIL Back to PBIL home page