(data stored in ACNUC7421 zone)

EMBL: CP001402.PE366

CP001402.PE366       Location/Qualifiers
FT   CDS_pept        319742..320221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41002"
FT                   /db_xref="GOA:C4KL37"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL37"
FT                   /protein_id="ACR41002.1"
FT                   /translation="MSHNFLIVLAAVSLAYLGFNVRVPLMRVVIGKRMSKEELSTYFTI
FT                   TPLFSIVSPLISGFIAQESYTIDFVVAFIFIIIVIPILFIIKSIVPLTEEKPITTTSHI
FT                   PFKEYSKLMREDRSGLIFALAVSCEQVYFWNKFFVYSALFYRDNKGKSTGVGNNA"
     ttgtcacata actttcttat agttttagct gcagtctctt tagcatattt aggctttaat        60
     gtaagagtac ctttaatgag agttgtaatt gggaagagaa tgagtaaaga agagctaagt       120
     acctatttca caataacgcc tttattttct atagtatcac ctttaatttc tggttttatt       180
     gcccaagaga gttatacaat tgatttcgtt gtagcattta tctttataat aattgtaatt       240
     ccaattctat tcataataaa gtctattgta ccactaactg aggaaaaacc tataactact       300
     acttctcata ttccatttaa ggagtattct aaattgatga gagaagatag aagtggatta       360
     atctttgccc ttgctgttag ctgtgaacaa gtttattttt ggaacaagtt ttttgtatat       420
     tccgctctat tttacagaga taataaaggg aagtctactg gagttgggaa taatgcttag       480
//

If you have problems or comments...

PBIL Back to PBIL home page