(data stored in ACNUC7421 zone)

EMBL: CP001402.PE367

CP001402.PE367       Location/Qualifiers
FT   CDS_pept        320214..320618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41003"
FT                   /db_xref="GOA:C4KL38"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL38"
FT                   /protein_id="ACR41003.1"
FT                   /translation="MLSTETIAISLASSLSKFISDRLGNVTTLAMTRILAAITYPLLYF
FT                   VKSPVIFILINWVGTLFIAMDNVPEVSVISKMKTANLSMSLIDSVSTLLSISSPIIALY
FT                   IWVNISPATVFLLSLLVIIPSILMFKYKVD"
     atgcttagta ccgagactat agccataagt ttagcctcat ctctatcaaa gttcatttca        60
     gacagattgg gtaacgtgac tacgttagca atgacaagaa ttctagccgc tataacgtat       120
     cccttacttt actttgtaaa atctcccgtg atctttatat taataaactg ggttggaaca       180
     ttatttatag ctatggataa cgtgccagag gtcagcgtaa tctctaagat gaaaacagct       240
     aatttatcca tgtcgttaat agattctgta tctacattac tatcaatatc ttctccaata       300
     attgctcttt atatttgggt aaacatatcc ccagctaccg tattcttact ctccctttta       360
     gtaataatcc catcaatatt aatgttcaaa tacaaagttg attag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page