(data stored in ACNUC7421 zone)

EMBL: CP001402.PE370

CP001402.PE370       Location/Qualifiers
FT   CDS_pept        323329..323694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0376"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41006"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL41"
FT                   /protein_id="ACR41006.1"
FT                   /translation="MKVAIAVTNGYVSGPGEGLAVQIYEINGNEYKIIEEYENPALNAT
FT                   AARGVHMLKSAIDKGVNAVVVAEMGPPGFRFLQRYNVKAYLGMGLDAKTALEKLIKNEL
FT                   LEITQPTHGERHGEHYH"
     atgaaagttg caatagcagt tacaaatggg tatgtttctg gaccaggtga aggattagct        60
     gttcaaattt atgaaataaa tgggaacgaa tacaaaataa tagaagaata tgagaatcct       120
     gcattaaatg ctactgcagc cagaggtgtg catatgttaa aatccgccat tgataaaggt       180
     gttaacgcag ttgttgtagc ggaaatgggt cctccaggat ttaggttttt acagaggtat       240
     aatgtgaagg catatctcgg aatgggtctt gatgctaaga ctgccttgga gaagctaatt       300
     aaaaacgaat tacttgaaat tacgcaacca acacatgggg agcgtcacgg ggaacattac       360
     cactag                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page