(data stored in ACNUC7421 zone)

EMBL: CP001402.PE377

CP001402.PE377       Location/Qualifiers
FT   CDS_pept        complement(327621..328592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0384"
FT                   /product="Protein of unknown function DUF973"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41013"
FT                   /db_xref="GOA:C4KL48"
FT                   /db_xref="InterPro:IPR009321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL48"
FT                   /protein_id="ACR41013.1"
FT                   /translation="MMSYSEVEYKGLSYLKRGNIEIIIIILIELLAILVTYVMEYLGLP
FT                   TPLQDFLVLLPSSAISTLLIILTYLDIQRGFYTLGKAEVNIGIGNIISSLFLVLSILAI
FT                   VGVVTYTLSLIFNGITSSILNPIQTLVELFAFITFIMLGFSYRLIGNHYGSNHLSIGGI
FT                   VLILGVIIFIFKLEYGGLLAFIGLIITYIGLGNLSAMKKLVTAPPPTQASSTPSETTSS
FT                   TNVSSSSPTPNIITHGGILRSNGEAFIAVSSDIEEEILSSIILNTDYSTNEITPKKLSK
FT                   GYNSIKINFNTNLQQLTLGNTYTIRLISANGRNIDINVVFQL"
     atgatgagtt acagtgaagt agaatataaa ggcttaagtt atttaaagag aggtaatatt        60
     gaaatcatta tcataatatt aattgagcta cttgcaatac tagtcactta cgtcatggaa       120
     tatctaggct tacccacacc actacaagac ttcctagtgt tattaccttc ctcagcaata       180
     tccacattat tgataatact aacatatctc gatattcagc gaggttttta tacattagga       240
     aaggcagaag taaatattgg gataggaaat ataatatcgt ccttgttcct agtattatcg       300
     atattggcaa tagttggagt cgtgacgtat acattgtctt taatatttaa cggcatcact       360
     agttcaatac ttaacccaat acagacatta gtggagttgt ttgcatttat aacgtttata       420
     atgttgggat tttcgtatag gctaatcggt aatcactatg ggagtaatca cttatcaata       480
     ggaggaattg ttttaatttt aggggttatc atattcatct ttaaactaga atatggggga       540
     ctcttggcgt ttataggttt aatcattacg tatataggac ttggtaactt atcagccatg       600
     aaaaagcttg ttactgctcc acctccaact caagcctctt ctactcctag tgaaactact       660
     tcatctacta atgtttcaag cagttctcct acgcctaata ttattacaca tggtggaata       720
     ttgagaagta atggagaagc gtttattgct gtctcctctg atattgaaga ggaaatactc       780
     agttctatta ttctaaatac agattactct acaaatgaga tcacaccaaa aaagttatca       840
     aaaggttata attccataaa aataaacttc aacactaatt tacaacagct tacccttggg       900
     aacacttata caattagact aatttcagca aatggaagaa atattgatat taatgttgtt       960
     ttccaactct aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page