(data stored in ACNUC7421 zone)

EMBL: CP001402.PE378

CP001402.PE378       Location/Qualifiers
FT   CDS_pept        complement(328641..329450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0385"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41014"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL49"
FT                   /protein_id="ACR41014.1"
FT                   /translation="MKKPKILLSVIKSLLENNGHITSRELPKSKKVSSNQLYKAILILN
FT                   KLGLIQIEGELNNNRFELHLVRDSQFLNLEQRVKVTFYEDRSKTKSFKFHTVALKNGVS
FT                   YIEDNSYWSVDDKVKTKLKVYKPKREFGKIIVEKIELGVQKAYIKLTLNPPTRVGEKII
FT                   HGFKVIQSNYFTFTQKETIERYGDPEMMDGLSVIQPTLFSTLEIKFPEGYRFIDVKAER
FT                   YDLVVIDGPQIPSPIPNHRLVIERNRIILKLVYPSFGYYFISWKAAQ"
     gtgaagaaac cgaagatcct gctaagcgtt ataaagagtt tattggaaaa taacgggcat        60
     attacatccc gagaacttcc taaatctaag aaagtttcat ctaatcagtt atacaaggct       120
     atactaatcc tcaataagtt aggactaatt caaattgagg gagagttaaa taataacaga       180
     tttgagctcc atctggttcg agactcccaa ttccttaatc tagaacaaag ggttaaagtt       240
     acattttatg aggataggag taaaactaaa agcttcaaat ttcatactgt tgcattaaag       300
     aatggcgtat catatattga agataatagt tactggtcgg ttgatgataa ggttaaaact       360
     aaattgaaag tctataagcc taaaagggaa tttggtaaaa taattgtgga gaagatcgaa       420
     ctaggagtcc agaaagctta cattaaacta acgttaaatc caccaacaag agtaggagag       480
     aaaataatac atggatttaa agtaattcag tctaactact tcacattcac gcaaaaggaa       540
     acaatagaga gatatgggga tcccgaaatg atggacggtt tatcagtaat acaacctacc       600
     ttattctcga cattagaaat taagttcccc gagggttaca gatttataga tgtaaaagcc       660
     gaaagatacg acttagtagt aatagatggt cctcaaatac cttctccaat accaaatcat       720
     cgtttagtta ttgaaagaaa taggattatt ctaaaactcg tttatccaag ttttggctat       780
     tattttattt cttggaaagc tgctcaataa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page