(data stored in ACNUC7421 zone)

EMBL: CP001402.PE381

CP001402.PE381       Location/Qualifiers
FT   CDS_pept        331982..332497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0387"
FT                   /product="protein of unknown function DUF1130"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41017"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL52"
FT                   /protein_id="ACR41017.1"
FT                   /translation="MLFTIGHSNRSLEDFMEILRKYNVEILIDVRRWPKSSRYPHFNKE
FT                   NLKKALEQSGIEYLWKEQLGGYRKIGKDVEDIDIGKCFKSEGFRAYAIYILTNERVMEA
FT                   LEDIRRINKIKVIMCSEKFPWNCHRKIISDWFLARGDEVVHLIEKESTIKHKLTTCAEI
FT                   VKNNLNYK"
     atgttgttta ctattggtca ttcaaataga agcttagaag attttatgga aatattaagg        60
     aagtataacg tggaaatatt aatagatgta aggagatggc ctaaaagttc tagatatcca       120
     cactttaaca aggagaatct caaaaaggct ttagaacaaa gtggtataga atatttatgg       180
     aaggaacagt taggaggata taggaaaatc ggaaaagacg ttgaagacat agatattggt       240
     aaatgcttta agagcgaggg ttttagagct tatgcaattt acattctaac taacgaaagg       300
     gttatggagg cattagagga tattaggaga attaataaga taaaggtgat catgtgctct       360
     gagaagtttc cttggaattg tcatagaaag ataatttctg actggttttt agctagggga       420
     gatgaagtag tacacttaat agaaaaggaa agcactatca aacataaact cactacatgc       480
     gcagaaattg tgaaaaataa tttaaactat aaataa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page