(data stored in ACNUC7421 zone)

EMBL: CP001402.PE383

CP001402.PE383       Location/Qualifiers
FT   CDS_pept        complement(333346..333981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41019"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL54"
FT                   /protein_id="ACR41019.1"
FT                   /translation="MSVSRVENYLNLQLKKALQINGIGVEEIHDIRVAVRKYFDVLYAL
FT                   YPVYENVECLFLAKEVISKLGKVRDMDICEIINEERNRLAIRAVKEVRGLKICFVNNNI
FT                   YGARLVIYNRILTSLHQIQDVTDFHELRKSVRVTRNLVEALGYDTTEIKAFAKKMGDIR
FT                   DEILKMRCRGVTPPDINVNQFKEEAKRVILKIIASQDEFHHFKLKDRY"
     ttgtcagtat cacgagttga gaattacctt aatctacagt tgaaaaaggc cttgcaaata        60
     aatggtattg gcgttgagga aattcacgat attagggtgg cggtgagaaa gtatttcgat       120
     gtactatatg ctctttatcc agtatacgaa aacgtggagt gtctattctt agcgaaagag       180
     gtaattagca aattaggaaa ggtgagagac atggatatct gcgaaataat taatgaagaa       240
     agaaatagac tagccattag ggctgtaaag gaagttagag gacttaaaat ttgctttgtc       300
     aataataaca tatatggtgc cagactagtc atatataata gaattctcac ctctctacat       360
     caaatacaag acgtgacaga ttttcatgaa ttaaggaaaa gcgtaagagt gactaggaat       420
     ctagttgagg ctcttggtta cgacaccacg gaaattaagg cttttgccaa gaaaatgggg       480
     gatataagag atgagatact aaaaatgaga tgtagaggag taactcctcc agatataaac       540
     gtaaatcagt tcaaggaaga agctaagagg gtaatactaa agatcatagc gtctcaagac       600
     gagtttcatc atttcaaact caaagataga tattaa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page