(data stored in ACNUC7421 zone)

EMBL: CP001402.PE384

CP001402.PE384       Location/Qualifiers
FT   CDS_pept        complement(333962..334579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0390"
FT                   /product="thymidylate kinase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41020"
FT                   /db_xref="GOA:C4KDP7"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDP7"
FT                   /protein_id="ACR41020.1"
FT                   /translation="MIIAFEGIEGSGKTSHLEATKKYLEKQGYGVITFGLQKSKLLGER
FT                   ITQVKRNIVFERRTLFLAYVTDLADQIENYVNPSIDSGFIALADGYTLTLTSWGLTRGL
FT                   EKEWIDDVLSILPKPSVSLPLISTPDEIVRRIIKKRGYLDPLETGIDICIKEDTFEAYI
FT                   DYINRFQEVLMSISSKENIIYTDKEFDEVQKEIVRRIVSITS"
     ttgataatag cctttgaagg aattgaagga tctggtaaaa catctcatct agaagctaca        60
     aaaaagtatt tggagaaaca aggatacgga gtaattacat ttggattgca gaagtcaaaa       120
     ttattaggag aaagaataac gcaagttaag agaaatatag tatttgagag aaggacatta       180
     tttttagcct atgtcacaga cttggctgat caaattgaga attacgttaa cccatcaata       240
     gattctggat ttatagcttt agctgacggt tatacactca cattaacttc atggggttta       300
     actaggggat tggagaaaga atggatagat gatgtcctct caattcttcc aaaaccttca       360
     gtttccttac cgctaatatc aactcctgac gaaatagtaa gaaggataat aaagaaaaga       420
     ggttatctag atccattaga aactggaata gacatctgta taaaggagga cacatttgag       480
     gcatacatag attacattaa taggtttcaa gaagttttaa tgtcaatctc ctccaaggaa       540
     aacataatat acaccgacaa ggaattcgat gaggtacaaa aggagatagt gaggagaatt       600
     gtcagtatca cgagttga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page