(data stored in ACNUC7421 zone)

EMBL: CP001402.PE385

CP001402.PE385       Location/Qualifiers
FT   CDS_pept        complement(334563..335204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0391"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41021"
FT                   /db_xref="GOA:C4KDP8"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDP8"
FT                   /protein_id="ACR41021.1"
FT                   /translation="MKGLLIAFEGIDGSGKSSQAVLLKDWIEMRRDVYLTEWNSSDWIH
FT                   DIIKEAKKKNTLTPTTFSLIHATDFSDRYERFILPMLKSGFVVICDRYIYTAYARDVVR
FT                   NVDFNWVKKLYSFAIKPNFTFYIRVTPEVALERIKKAKRKIKPQEAGIDILGELPLEEG
FT                   FLKYQGMVVEIYDKIAKEESNFITIDGNRPLKDVQMDIRKILGEYIDNSL"
     atgaaaggtt tgttaatagc ttttgagggt atagatggtt ctggtaagtc tagtcaagcg        60
     gtattactca aagattggat tgaaatgaga agagacgttt acctaactga gtggaactca       120
     tctgactgga tccacgatat aataaaagaa gctaaaaaga agaatacgct cacacccaca       180
     acctttagcc ttattcatgc gactgatttt tcagataggt atgaaaggtt cattttgcca       240
     atgcttaaaa gtggatttgt tgttatatgc gatcgctaca tatacactgc ttacgctaga       300
     gatgtggtta ggaacgtgga ctttaattgg gtgaagaaac tgtattcctt tgcgataaag       360
     cctaatttta ccttttacat aagggtcaca ccagaagtcg ccttggagag aattaaaaag       420
     gctaagagga agataaagcc acaagaagct ggaattgata tattgggtga gcttccattg       480
     gaagagggct ttttaaaata tcaaggtatg gttgtagaga tttacgataa aatagctaaa       540
     gaggaaagca atttcataac gatagatgga aatagaccac taaaggacgt tcagatggac       600
     ataagaaaga ttttgggtga atacattgat aatagccttt ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page