(data stored in ACNUC7421 zone)

EMBL: CP001402.PE388

CP001402.PE388       Location/Qualifiers
FT   CDS_pept        337454..337588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41024"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ1"
FT                   /protein_id="ACR41024.1"
FT                   /translation="MKVVTNEIGKRRKIPGIYVNLQGIRSLNSLLSILVSEINKERIS"
     atgaaagttg ttacaaatga gatagggaaa aggagaaaaa tacccggtat ttacgttaat        60
     ttacaaggaa taaggagtct aaattcactt ctatcgattt tagtctcaga aatcaacaaa       120
     gagagaattt cgtga                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page