(data stored in ACNUC7421 zone)

EMBL: CP001402.PE389

CP001402.PE389       Location/Qualifiers
FT   CDS_pept        337585..337776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2833"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2833"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41025"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ2"
FT                   /protein_id="ACR41025.1"
FT                   /translation="MRFKVNINFLVTSAGIEIRGGRRRVVNSLIETPNSSDEIVIAFDE
FT                   VQELSFTSKQFYFGERLR"
     gtgaggttta aagttaacat taacttcctt gtaacttcgg cgggaattga aattagagga        60
     ggtagaagaa gagttgtaaa tagtttaata gaaactccta actcttcaga tgagatagtt       120
     attgcattcg atgaggtgca agagttatcc tttacatcta agcagtttta ttttggggaa       180
     cgtttacgct ag                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page