(data stored in ACNUC7421 zone)

EMBL: CP001402.PE39

CP001402.PE39        Location/Qualifiers
FT   CDS_pept        35299..36039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0039"
FT                   /product="protein of unknown function Met10"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40675"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF5"
FT                   /protein_id="ACR40675.1"
FT                   /translation="MKTERLNAYFPGVRSYYIIGEIAIVTPKRVNVDYNLVAQKIMQAH
FT                   PKIKAVYLKKKVKGELRTNELEFLSGERISSTIYKENGVLFYVDIVTVYVNPSLSGDRL
FT                   KNVELVEEGSIILDAFTGYGAIALNIAHKKRAFVVAGDVNIDGLYMLKKSLSLNKIKGM
FT                   IDIVQYDAHYLPFRDKVFKLSFGDNPTLIIDFKEELCRVSENVVFYILCESKDKANSSL
FT                   GKTEWVKINDYSKNLFIFKGVVRC"
     atgaagactg aaaggcttaa cgcgtatttc cctggcgtga gaagttatta cattataggc        60
     gagatagcta tagtaactcc taaacgagtt aacgttgatt ataatttagt tgctcagaag       120
     attatgcaag ctcatcctaa gataaaggcc gtatatctta aaaagaaggt aaaaggcgaa       180
     ttaagaacaa acgaattaga atttctatct ggagaaagaa tatccagcac aatctacaag       240
     gagaacggag tattatttta tgtagatata gtcacggttt atgttaatcc ttctctttct       300
     ggggatagac taaaaaatgt ggaacttgtt gaagaaggaa gtattatatt agatgctttt       360
     actggttatg gtgctattgc actaaatata gctcataaaa aaagggcttt tgttgttgct       420
     ggggatgtta atatcgatgg attgtatatg ctcaagaagt ctttaagtct gaataagata       480
     aaaggtatga tagatatcgt tcaatatgat gcgcactatc tgccatttag ggacaaggtc       540
     tttaagttat cttttggaga taatcctact ttgataattg atttcaaaga agagttgtgc       600
     agagtttctg aaaatgtcgt attttacatt ttgtgcgaat ccaaagataa ggcaaattca       660
     agtttaggta aaactgagtg ggttaagatc aacgactatt ctaagaatct ctttatcttc       720
     aagggggttg tcagatgcta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page