(data stored in ACNUC7421 zone)

EMBL: CP001402.PE390

CP001402.PE390       Location/Qualifiers
FT   CDS_pept        complement(337881..338774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0395"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41026"
FT                   /db_xref="GOA:C4KDQ3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ3"
FT                   /protein_id="ACR41026.1"
FT                   /translation="MSSLVTPKRIPKFYRGNAACPGCPIPKELDVLLEVLGNKTVLVVP
FT                   ASCTTIIMGDTSGMPSTVPVIHSAFGAPAAIASGIVRALRTRGDKDVIVTVWAGDGSTG
FT                   DIGFASLSGAAERNEDILYVCYDNEAYMNTGIQRSSLTPKGAWTTTTPEGKREYKKPLP
FT                   FIIAEHKVPYVATASIAYIYDYEAKVRKAKQIRGFRYLHLLSPCPPGWRFDSKLTIDTA
FT                   KLAVETGVWPLFEIENGEFRLTSVSKTLLDKKNRKQVAEYLKLQGRFKQLTEEEIKGIQ
FT                   EEIDEMWEEIKKLVKK"
     gtgagtagtt tagttacacc taagaggata cccaagttct atagaggtaa tgctgcttgt        60
     ccgggttgcc caatacctaa agagttagat gtactcctag aggttttagg aaataaaacc       120
     gttctagtcg ttccagcctc atgtaccaca ataataatgg gagatacaag tggaatgcct       180
     tcaactgtcc cagtgataca tagtgcattt ggtgctcccg cagctatagc ttcaggcatt       240
     gttagagctt taaggactag gggagataag gatgtaatag taaccgtatg ggctggtgat       300
     ggttctactg gagatatagg atttgcatca ttaagcggtg ctgcagagag aaatgaggat       360
     atcctttacg tatgttatga taacgaagcg tatatgaata ctggaattca acgttcaagc       420
     ttgacgccaa aaggcgcatg gacaacgaca actccagaag gtaagaggga atataagaaa       480
     cccttaccat tcataattgc agaacataaa gtaccatatg tagctactgc ttcaattgct       540
     tacatatacg attatgaagc caaggtgagg aaagctaagc aaattcgtgg atttagatat       600
     ttacacttat tatccccatg tccgcccgga tggcgtttcg actctaaatt gactattgac       660
     actgcgaaac ttgcagttga gactggagtt tggccactct ttgaaataga aaatggtgag       720
     tttagattga ctagtgtaag taagacacta cttgacaaga agaataggaa acaagtagcg       780
     gagtatttaa aattgcaagg aagatttaaa cagctcactg aagaggaaat aaagggtata       840
     caagaggaaa tcgatgagat gtgggaggaa attaaaaaac tagttaagaa gtaa             894
//

If you have problems or comments...

PBIL Back to PBIL home page