(data stored in ACNUC7421 zone)

EMBL: CP001402.PE391

CP001402.PE391       Location/Qualifiers
FT   CDS_pept        complement(338771..339928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0396"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41027"
FT                   /db_xref="GOA:C4KDQ4"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ4"
FT                   /protein_id="ACR41027.1"
FT                   /translation="MQVLKRKTLALVGNHAVAYAVKQSKPQVLAVFPITPQTTMLEKIS
FT                   EYIASEELNAELIKVESEHSALASIYGAALAGARVFTATSSQGLLYMTEMIYWAGGQRV
FT                   PMVAAVATRAIAEPWSIWDDHQDFLSKRDAIWIQMMAENVQEAYDMTIQAFRISEDERV
FT                   ILPVMMGFDGFILTHTMERIEVLEDGEVDNFLPPRQFNLIDFSDPIGVGPIATPEDYIK
FT                   YRYEAMKAMERAKGVIEEVMNEYGRISGRKQNGLVECYKCEDAKYVFVTMGAWSGDGKV
FT                   AVDRLRDAGVEAGLLKIRVFRPFPKEKIEEYLRSMKGVIVLDRAYSYGSGGILANEIKA
FT                   TLYGYRVPVYSVIAGIGGKDVRPRHFQKVIEDLINDNLEEERWLL"
     atgcaagttt taaagaggaa aaccttagct ttagttggta atcacgcagt tgcttatgct        60
     gttaagcaat ctaaacctca agttttagcg gtgttcccaa taactcctca aactacaatg       120
     ctagagaaaa tttccgaata catagcttct gaggaattaa atgctgagtt aataaaggtg       180
     gaaagtgagc attctgcgtt ggcttcaatt tatggtgctg cattggctgg tgctagagtt       240
     ttcactgcaa cgtcttctca aggactacta tacatgactg agatgatata ttgggctgga       300
     ggtcaaagag tccctatggt tgctgcagtt gcaactaggg caattgcaga gccttggagt       360
     atttgggatg atcatcaaga tttcctaagt aagagagatg caatttggat tcaaatgatg       420
     gcagaaaacg ttcaagaggc ttacgatatg acaatacaag cgtttagaat ttcagaagat       480
     gagagagtaa tcttaccagt catgatggga tttgatggct tcatattaac tcacacaatg       540
     gaaaggattg aggtattaga ggatggtgag gttgacaact ttttaccgcc tagacaattt       600
     aacctaattg acttctctga tcctattggt gttggaccaa tcgcaactcc agaggattac       660
     atcaagtata ggtatgaggc tatgaaggcc atggaaagag ctaaaggggt tattgaggaa       720
     gtaatgaatg aatacgggag gataagtgga aggaaacaaa acggtttagt cgagtgttat       780
     aaatgtgaag atgccaaata cgttttcgtt accatgggag cgtggagtgg tgacggtaag       840
     gttgctgtgg atagactaag ggatgctggg gttgaggctg gattgctcaa aatcagggta       900
     tttagaccat tcccaaagga gaaaatagag gaatacttaa ggtcaatgaa aggtgtaata       960
     gttctcgata gagcttattc atatggttct ggggggattt tagcaaatga gataaaagct      1020
     acactttatg gctatagagt accagtttac agcgtaatag caggtattgg tggaaaggac      1080
     gttagaccac gtcactttca aaaggtgatt gaagacctaa tcaacgataa tttggaagag      1140
     gagaggtggt tgttgtga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page