(data stored in ACNUC7421 zone)

EMBL: CP001402.PE392

CP001402.PE392       Location/Qualifiers
FT   CDS_pept        complement(339932..340198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0397"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41028"
FT                   /db_xref="GOA:C4KDQ5"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ5"
FT                   /protein_id="ACR41028.1"
FT                   /translation="MIKIPMGVPVARPRIGSAGKTGLWRVEKPVIDYNKCTKCRLCVIY
FT                   CPENTIDLLENLYPQIDYDYCKGCGVCAQVCPPKAIDMVREVK"
     ttgattaaaa tccccatggg agtgccagta gctaggccaa ggataggatc tgcgggaaaa        60
     actggattat ggagagttga gaaaccagta attgattaca ataagtgtac taagtgtaga       120
     ctttgcgtaa tttattgccc agaaaatact attgatctcc tagagaacct ctatcctcaa       180
     attgattacg attattgtaa aggttgtggt gtttgcgcac aagtttgccc acctaaggca       240
     atagatatgg ttagggaggt gaagtga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page