(data stored in ACNUC7421 zone)

EMBL: CP001402.PE393

CP001402.PE393       Location/Qualifiers
FT   CDS_pept        complement(340191..340739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0398"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41029"
FT                   /db_xref="GOA:C4KDQ6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ6"
FT                   /protein_id="ACR41029.1"
FT                   /translation="MTLIELALRGRGGQGIVTAGELVTKAMVLEDKYAQSIPFFGGERR
FT                   GAPVVSFLRLSDKPILLHREVYNPDGVAIFDTSLIQIINVTEGLKENGFLLLNTNTPKR
FT                   IWKSEYIIDATSIAKELGLVVAGWAVVNTAMIGALVKILGQPSLHSLEETVKEEFPGKI
FT                   GELNAEAVEMGYKGVKRVD"
     atgactctta ttgaattagc tttaagggga aggggagggc aaggaatagt tactgctggg        60
     gaacttgtta caaaggccat ggttttagag gataaatacg cccaatccat accctttttc       120
     ggtggggaaa ggagaggagc tccagtcgta tcatttctaa ggctgtcaga taagccgata       180
     cttttacata gagaagttta caatccagac ggtgttgcaa tatttgatac gtcactcatt       240
     caaataatta acgttacaga gggactcaaa gaaaacggtt tcttactact aaacacaaat       300
     acgcctaaga gaatttggaa aagtgagtat atcattgacg ctacaagtat tgctaaagaa       360
     ttagggctag tcgtagctgg atgggctgtt gttaataccg cgatgatagg agctttagtg       420
     aaaatcttgg ggcaaccttc cttacactcg ttggaagaga ctgtaaagga agaattcccg       480
     ggaaagatag gggaactcaa tgcggaagca gttgaaatgg gatataaggg ggtgaaaagg       540
     gttgattaa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page