(data stored in ACNUC7421 zone)

EMBL: CP001402.PE396

CP001402.PE396       Location/Qualifiers
FT   CDS_pept        complement(342126..342587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41032"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ9"
FT                   /protein_id="ACR41032.1"
FT                   /translation="MPNEGIKLIFSLQTNLSFLIRTTEGKLTVLIRNAKNKYKSSTTLI
FT                   IMLEEWIKQLAYALDKFVADEQLTEDERIMVASLIYATLKHLKDFDECNEKLKEVEEKC
FT                   NKNPDELEKKLDELQKELDKKEVEVKEKLKTLDNLIKIMEVNPRLLPKN"
     atgccgaacg aaggcatcaa attaatcttc tcattgcaaa ctaatttaag ctttctcata        60
     cgcacaacag aagggaaatt gacggtttta ataaggaatg caaaaaataa atataaatcc       120
     tctactactt tgattataat gcttgaagaa tggataaaac aacttgccta tgcattagat       180
     aagtttgtgg ctgatgagca attaacagaa gatgagagaa ttatggtagc ctctctcatt       240
     tatgcaacac tgaaacacct taaggatttc gacgagtgta acgagaaact taaagaagtt       300
     gaagaaaaat gtaacaaaaa ccccgatgag ttagaaaaga aattagacga attgcaaaag       360
     gaattagaca agaaagaggt ggaagtgaaa gagaagttga aaactttgga caatttaata       420
     aaaataatgg aagtaaatcc tagattatta cctaaaaact aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page