(data stored in ACNUC7421 zone)

EMBL: CP001402.PE397

CP001402.PE397       Location/Qualifiers
FT   CDS_pept        342523..342993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41033"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR0"
FT                   /protein_id="ACR41033.1"
FT                   /translation="MRMRKLKLVCNEKINLMPSFGIMTDIVTEELKEELRKKLGREIPN
FT                   VSVEFVNYLPPQVLAYVRANDYTIYVNYEQYMRAKRMGYEYEYLYVILLHEYLHVVGIA
FT                   DEREVRRIDLEMVRDKFGENSTAYKIALNLADPRDIYLNESQRLGGKPNTFM"
     gtgcgtatga gaaagcttaa attagtttgc aatgagaaga ttaatttgat gccttcgttc        60
     ggcattatga cagatattgt aactgaagag cttaaggaag aactaaggaa gaagttagga       120
     agggaaattc ccaacgtttc agttgagttt gttaattacc tccctcctca agtattggca       180
     tatgtgagag ctaacgatta cacaatatat gtaaactacg agcagtatat gagagctaag       240
     agaatgggat atgaatacga gtatttgtac gttatactac tgcacgaata cttacacgtg       300
     gttgggattg ccgatgaaag ggaggtaaga aggatagatt tagaaatggt gagggataag       360
     tttggtgaaa atagcacagc gtataagata gccttaaatt tggctgatcc tagagatata       420
     tatttaaacg agtctcaaag gttgggtgga aagccaaaca ccttcatgta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page