(data stored in ACNUC7421 zone)

EMBL: CP001402.PE4

CP001402.PE4         Location/Qualifiers
FT   CDS_pept        2400..3233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0004"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40640"
FT                   /db_xref="GOA:C4KJC0"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC0"
FT                   /protein_id="ACR40640.1"
FT                   /translation="MIPVIIASAQTSVSQALSGIATSIIDAIPSIIVFIIILIIGYIIA
FT                   NIVSYSIRAFLGRIFREEHVRASVDIIAGTIKALIILIALSIALSFLQLGAASGYVQQI
FT                   ANYLPKLAGAIVLLTIGLTLVNILVDYMQRQIGARSQDDLITAIFNVLRFGLYAAIITV
FT                   AAALAIFSVIPYVDPYVFYAVILGAVILYAAYALIDKVLVPFANSNPDLAYVANYGRLI
FT                   LYIIVLLIAIAIIVEPFGNVTSIIYALSWGLAIAFAIALIPLVIALVKKFLAEIK"
     gtgatacctg tgataatagc atcagctcag acatcggttt cccaagcgtt atctgggata        60
     gcgactagta ttattgacgc aataccttct ataatagtgt ttataataat actaataata       120
     ggttatataa tagctaatat agtatcgtat tccattaggg catttttagg taggatcttc       180
     agagaagaac acgttagagc tagtgttgac attatagcag gtacgataaa ggcgttaatc       240
     atattaattg cactatcaat agctctttct tttctacagc taggagcagc ttctggatat       300
     gttcaacaga tagctaatta tttgcctaag ttagctgggg ctatagtact ccttaccata       360
     ggcttaactc tagttaatat tttagttgat tacatgcaga ggcaaatagg agctagatct       420
     caagatgatt taataactgc gatatttaac gttctgaggt ttggtctata tgctgcaata       480
     ataactgttg ctgcagcctt agcaattttt agtgttatac cgtatgtcga tccttatgta       540
     ttttatgcag taatattagg tgcagtaata ttatacgcag catatgcttt gattgataaa       600
     gtgctagttc cctttgcgaa ctctaatcca gacctagcct atgtagcaaa ttatggtaga       660
     ctgatattgt atataattgt actactaatt gcaattgcta taatagttga acccttcgga       720
     aacgttacat caataatata cgctttatca tggggtctgg cgatagcttt tgccatagca       780
     ttaattcctc tagttatagc tttagtaaag aaattcttag cagaaattaa gtga             834
//

If you have problems or comments...

PBIL Back to PBIL home page