(data stored in ACNUC7421 zone)

EMBL: CP001402.PE40

CP001402.PE40        Location/Qualifiers
FT   CDS_pept        complement(35962..36447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0040"
FT                   /product="Protein of unknown function DUF371"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40676"
FT                   /db_xref="InterPro:IPR007171"
FT                   /db_xref="InterPro:IPR023131"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF6"
FT                   /protein_id="ACR40676.1"
FT                   /translation="MIAIDKIKIKGHYNIRGLHKTTLEITKDHYLTTRGDCIIGILANK
FT                   GARDLSESFKKIARNDERFIYAVIRVKELFDIIHGRGSSKFTFENQNKIIFRKSTFIEG
FT                   STVMIRSDKAARDINREIINLLKTEVEGEVHILASDNPLEDKEILRIVVDLNPLSFT"
     ttgatagcaa tagacaagat aaagatcaag gggcattata acattagagg attacataag        60
     accacattag aaataactaa ggatcattat cttacgacta gaggagactg tataatagga       120
     atattagcca ataaaggtgc aagagatcta agtgaaagct tcaaaaagat tgctagaaac       180
     gatgaaaggt ttatttacgc ggtgattagg gtgaaagagc tctttgacat aattcacggt       240
     agaggttcat ctaaatttac ttttgagaat caaaataaaa ttatattcag aaaatctact       300
     tttatagaag gatcaacagt aatgataaga tcagataaag cagcaagaga tataaataga       360
     gaaataatta acttgcttaa aactgaagtt gagggagaag ttcatatttt agcatctgac       420
     aacccccttg aagataaaga gattcttaga atagtcgttg atcttaaccc actcagtttt       480
     acctaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page