(data stored in ACNUC7421 zone)

EMBL: CP001402.PE400

CP001402.PE400       Location/Qualifiers
FT   CDS_pept        343628..344971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0406"
FT                   /product="FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41036"
FT                   /db_xref="GOA:C4KDR3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR3"
FT                   /protein_id="ACR41036.1"
FT                   /translation="MDFTELKDIEQKVEEREDFSGEKVRPLAVFFPKDEDEVVRIVRFA
FT                   KKNRLPIIPWGQGTSLTGAVSCDKNCILVDLSKMNKILEINDIDWYVRVQPGIKLIDLF
FT                   EELEKKGFMLPPDPASFFLCSVGGAVAESSGGMKGVRHGSFREWVLSLRVVLPNGEVIK
FT                   VGEPLRKNRAGYDLVHLFVGSEGTLGIVTEIWLRIIPIPKRKMVMIAAMLKDFESAGEV
FT                   IVGLRKNKILPELSEYVDADVVKALNKHLSANLKETEGGMLLISIEEDSVDDVLKVLEG
FT                   KAVDIKIAEGEEAEKLYSLRSQAAIAVKAESNKVFYAEDIVVPVSKLPEAIRRLREIGE
FT                   KYNTKFYVISHIGDGNLHPNIIIEDKVARENAFEEIARMAIELGGSVSGEHGIGVQKAK
FT                   LMAEQIVKHNGVSVLDLMYQIKKLIDPDDIMNPDKYVELAYKFLTSRG"
     atggatttca ccgaattgaa agatatcgag caaaaggtag aggaaaggga ggatttttcc        60
     ggagagaaag taagaccatt agccgtattc ttccctaagg atgaggatga agtcgttagg       120
     attgttagat ttgctaagaa aaatagatta cccataatac catggggtca aggaactagt       180
     ttaaccggag ctgtttcgtg cgataaaaac tgtatattag tagacctatc taaaatgaat       240
     aaaattttag agataaacga tattgattgg tacgtaagag tccaaccggg gattaaatta       300
     atagacctct tcgaggaact agagaaaaaa ggctttatgt tacctccaga tccagcaagc       360
     ttctttttat gctcagttgg tggggcagta gctgaatcct ctggagggat gaagggtgta       420
     aggcacggtt cattcaggga atgggtatta tctttacgtg ttgttttacc aaatggggag       480
     gtaattaagg tcggagaacc attgaggaag aatagggccg gatatgattt ggttcattta       540
     ttcgttggaa gtgagggaac tttaggtatc gtaacggaaa tctggttgag gataatacca       600
     attccaaaga gaaagatggt tatgatagct gcaatgttaa aggattttga atccgctgga       660
     gaagttatag taggcttgag gaagaataag atattgccag agctgtcaga gtacgttgat       720
     gctgatgtag tcaaagcgtt aaataaacac ttgagtgcaa acctcaagga aacagaggga       780
     gggatgttat taatttcaat agaggaagat agtgtcgatg atgtgttaaa agtattagag       840
     ggaaaggcag ttgatattaa gattgctgaa ggtgaagagg cagagaaatt gtattcattg       900
     agatcacaag ctgcaatagc agtgaaagct gaatcaaata aagtatttta cgctgaagat       960
     atagtagtac cagtttctaa actgccagaa gctataagga gactcagaga aataggtgag      1020
     aagtataata ctaaattcta cgttatctcg catataggtg atggtaatct tcatccaaac      1080
     ataataattg aggataaggt agcaagggaa aatgcatttg aggaaatagc tagaatggcg      1140
     attgagcttg ggggttctgt tagtggagag catggaattg gtgtgcagaa ggctaagtta      1200
     atggctgagc aaatagttaa acataatggc gttagtgtat tggatttaat gtatcagata      1260
     aagaagttaa ttgatccaga tgatataatg aaccctgaca agtatgtcga attggcatat      1320
     aagtttttaa cttctagggg gtag                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page