(data stored in ACNUC7421 zone)

EMBL: CP001402.PE401

CP001402.PE401       Location/Qualifiers
FT   CDS_pept        complement(345045..345440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0407"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41037"
FT                   /db_xref="GOA:C4KDR4"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR4"
FT                   /protein_id="ACR41037.1"
FT                   /translation="MTSKGKYFDVNVFVYYLTGDRIYGERAKKWLSIKDDDKYTSIITP
FT                   FLLIIVVSRILGKSIKDYNFIKTAITALESLGIGYLELPEWSKIVENVRKYSIDIEDSI
FT                   HVTTALENGLEIVSNDEELKKKVNAEF"
     atgacaagta agggaaaata ttttgatgta aatgtttttg tctactatct aactggtgat        60
     aggatatatg gtgaaagagc taagaagtgg cttagtatta aagatgatga taaatacact       120
     tcaattataa ccccattttt attaataata gtagtaagta gaatactcgg taaatcaata       180
     aaggactata atttcattaa aacagcaatc acagcccttg agtctttagg aataggatat       240
     ttagaactcc cagagtggag taaaattgtt gaaaacgtta gaaaatacag tatagatatc       300
     gaagattcta ttcacgttac aacagcgtta gagaatggat tagagattgt atcgaacgac       360
     gaagaattaa agaagaaagt taatgcggaa ttttaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page