(data stored in ACNUC7421 zone)

EMBL: CP001402.PE405

CP001402.PE405       Location/Qualifiers
FT   CDS_pept        complement(348089..348775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0411"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41041"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR8"
FT                   /protein_id="ACR41041.1"
FT                   /translation="MNDRLLEITFSVEHENCWTNLVGKYIVKTLRFSVDTERNSIRSLI
FT                   VVDKKYKDLMNKIKRNNSFIGYSSISLTNDNKKILFDFRKRYKNSVMDIINSIDGIILD
FT                   GFKYDGKEYWRILLYESYINELREKLRSKGNVEFIGFHELNVTEDELTPYELKTLILAY
FT                   KNGYFDFPRRIKSDKISKLINISKSTFTYHLRSAESRIIKRYIDDLKFYNVINNISQQE
FT                   EERKDS"
     atgaatgaca gactattgga aattacgttt tcagttgaac atgagaactg ttggactaat        60
     ctagttggta aatacattgt gaaaactttg agattttctg tagatactga gaggaactct       120
     attaggtccc taatcgttgt ggataaaaaa tacaaggatt taatgaataa gataaagaga       180
     aataatagtt tcattggata ctcatcaatt tctctcacaa atgacaataa gaaaatactt       240
     tttgatttca gaaagaggta caaaaatagt gtaatggaca ttataaactc catagatggg       300
     ataatcttag atggatttaa gtatgatgga aaggaatatt ggcgaatttt attgtatgaa       360
     agttacatta atgaattaag ggagaagctt aggtctaaag ggaatgtgga gtttattggc       420
     tttcacgaat taaatgtaac tgaggatgaa ctgactccat atgaacttaa aactttaatt       480
     ttggcttata aaaatggcta ttttgatttt cccaggagaa ttaagtctga taaaatatct       540
     aaattgataa atataagtaa atccactttc acgtaccatt taagatcagc tgagtcgaga       600
     ataattaaac gatatattga cgacctaaaa ttctacaatg taattaacaa catatcgcag       660
     caagaagagg aaagaaagga tagctaa                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page