(data stored in ACNUC7421 zone)

EMBL: CP001402.PE406

CP001402.PE406       Location/Qualifiers
FT   CDS_pept        349009..350094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0412"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41042"
FT                   /db_xref="GOA:C4KDR9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR9"
FT                   /protein_id="ACR41042.1"
FT                   /translation="MKAARLVEFQKPLKIEDLEVPKVGKGDVLLKVISCGICRSDWHLW
FT                   RGDPALVAYMQWSGGKLPITQGHEVYGEVVEVGESVAKLKKGDKVVMPASSTGDNRTCK
FT                   YCMEGDSNVCDHLVIAGYGINGCFAEYMLVPERSVIDLVKVPDGIKPEWAALSSCGFGT
FT                   SWNAFTMKTNLKPGDMVLTIGAGGMGLSGIVIANALGAKVIAVDVNERSLEKAKILGSI
FT                   ETYKYSGKSEELNEIVEDIMRKYGSVDVVYDTTGIPEAVIPFLPLLRVHGTLLLAGLMM
FT                   KGKETFPLPADLVVAREIRIQGVLMLPAQKFDTIFKLMKEGKINLDPVTYKTISIYDVN
FT                   DAYKEMSEYKNAGRIIINKFS"
     atgaaggcag ctagattagt ggaatttcaa aagcctctga agatagagga tctcgaagtt        60
     cctaaagttg gaaaaggaga tgtacttcta aaagtgataa gctgtggaat atgtagatca       120
     gattggcatc tatggcgtgg agatcctgct ttggtagcat atatgcagtg gagtggtggt       180
     aagttaccaa taactcaagg tcatgaggtt tatggagaag tcgtagaggt cggagagagt       240
     gtagctaaat tgaaaaaggg agataaggta gtcatgcctg cttcttctac cggagataat       300
     aggacatgca aatactgtat ggaaggagat tcgaatgttt gtgatcactt ggtaatagct       360
     ggttatggaa ttaatgggtg ctttgctgag tacatgttag tcccagagag gtcagtaatt       420
     gatctagtta aagtaccaga tggaataaag ccagagtggg ctgctctaag ttcttgtggt       480
     tttggaactt catggaacgc gtttacaatg aagactaatt taaagcccgg tgacatggtg       540
     ctcacaatcg gagcaggagg gatgggtttg agtggtatag taatagctaa cgctcttggt       600
     gctaaagtaa tagctgtaga cgttaacgaa cgatctttag agaaagctaa aatattaggt       660
     agcattgaga cttataaata ttctggtaag tctgaagaat tgaatgaaat agtagaggat       720
     attatgagga agtatggttc agtggacgta gtgtatgata ctacaggaat tccagaggct       780
     gtcataccgt ttttacctct ccttagagtg catgggacat tactattagc ggggcttatg       840
     atgaagggga aagagacttt tccattgcca gcagatttag tggtagcaag ggaaatcaga       900
     atacaaggag tattaatgtt accagctcaa aaattcgata caatatttaa attaatgaaa       960
     gaaggaaaga ttaatctaga tccagttacg tacaagacta taagcatcta tgatgtcaat      1020
     gatgcctaca aggaaatgag cgagtacaaa aatgcaggaa gaattattat taataagttt      1080
     agctaa                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page