(data stored in ACNUC7421 zone)

EMBL: CP001402.PE41

CP001402.PE41        Location/Qualifiers
FT   CDS_pept        complement(36407..36700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0041"
FT                   /product="protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40677"
FT                   /db_xref="GOA:C4KJF7"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF7"
FT                   /protein_id="ACR40677.1"
FT                   /translation="MYSQEIKDLIKKTRAERADIRIGKYGVTEGMLNEIKRRLNEHKVI
FT                   KIKIGIKEIDDRKEFAKRVAEMVGAKLIEVRGYTFILAKVDSNRQDKDQGAL"
     atgtactctc aagaaataaa ggatctaata aagaaaacta gggctgaaag ggcagatata        60
     agaataggta aatatggtgt aactgaaggt atgctgaatg aaataaaaag gagattaaat       120
     gaacataaag tgataaagat aaaaatagga attaaggaaa ttgatgatcg aaaagaattc       180
     gcaaaaagag ttgcagagat ggttggagct aaacttatag aggtaagagg atatactttt       240
     atactagcca aagttgatag caatagacaa gataaagatc aaggggcatt ataa             294
//

If you have problems or comments...

PBIL Back to PBIL home page