(data stored in ACNUC7421 zone)

EMBL: CP001402.PE410

CP001402.PE410       Location/Qualifiers
FT   CDS_pept        353062..353481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0416"
FT                   /product="protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41046"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS3"
FT                   /protein_id="ACR41046.1"
FT                   /translation="MNVLNKLGISDELADMLISEAVKKAKELGVKVSIAIVDEGGELKA
FT                   FKRMDGAPILTIEIAIDKAWTAVSFGIPTHEWYNMLKDNPPLAMGFPKIPRLIIFGGGF
FT                   PIVYKGQVIGGIGISGGSAEQDMEIAKNTLKKLES"
     gtgaatgtgc taaataagtt aggtatatca gacgaattag cagatatgtt aataagtgag        60
     gcagtaaaga aggctaaaga gttaggagtg aaggtttcta tagcaatagt agatgaagga       120
     ggagagttga aggcttttaa gagaatggac ggtgcaccaa tcttaaccat agagatagcc       180
     atagataaag cgtggactgc ggtaagtttt ggtataccaa cacacgagtg gtacaacatg       240
     cttaaagaca accccccact ggcaatggga tttcctaaaa tacctaggtt aataatcttc       300
     ggtggaggat ttcctatagt ctataaaggg caagtaatag gaggaatagg aatatctggc       360
     ggatctgcgg aacaagatat ggaaattgcc aaaaatactc ttaaaaaatt ggaatcataa       420
//

If you have problems or comments...

PBIL Back to PBIL home page