(data stored in ACNUC7421 zone)

EMBL: CP001402.PE412

CP001402.PE412       Location/Qualifiers
FT   CDS_pept        354969..355130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41048"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS5"
FT                   /protein_id="ACR41048.1"
FT                   /translation="MGYAQKGEGDYGDVSPAPLGSKESHDPPTISRWLRAKSLHSIMNE
FT                   YKMSEMKV"
     gtgggctatg cccaaaaggg tgagggggat tacggagatg tgagccccgc gccgttgggc        60
     tcaaaggagt cccatgatcc acctaccata agtaggtggt tgagggctaa gtccctacac       120
     tcgatcatga atgaatataa aatgagtgaa atgaaagtgt ag                          162
//

If you have problems or comments...

PBIL Back to PBIL home page