(data stored in ACNUC7421 zone)

EMBL: CP001402.PE415

CP001402.PE415       Location/Qualifiers
FT   CDS_pept        357098..357532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41051"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS8"
FT                   /protein_id="ACR41051.1"
FT                   /translation="MSMEAVPIVFVPEEGTVWLPAVLPTNITVEEAIEMLKSLTVNVLV
FT                   WEKKDKDLRLVNYFTGQVLELNAKVRDVIKPYDVFWLVWWPPKEEFWKPENQNDDIFKI
FT                   IKETEEAIKLAPRSPSVLFTDEIEKYSIVRRLEREGKLRA"
     atgagtatgg aagcagtacc catagtattt gtcccagaag aaggcacagt gtggttaccc        60
     gctgtacttc caacaaacat tacggtagaa gaggctattg aaatgttgaa gagtctaaca       120
     gtaaacgtgt tagtatggga aaagaaggat aaggacttaa gattagttaa ctactttact       180
     ggtcaagtct tagagcttaa tgccaaagtt agagacgtaa taaagccata tgacgttttc       240
     tggttagtct ggtggcctcc taaggaagag ttctggaagc cagagaatca gaacgatgat       300
     atattcaaga ttataaagga gactgaagag gctataaagt tagccccaag atctccttca       360
     gtactcttta cagatgagat tgaaaaatat agtatcgtta gaagattgga aagggagggt       420
     aaattaaggg cgtga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page