(data stored in ACNUC7421 zone)

EMBL: CP001402.PE416

CP001402.PE416       Location/Qualifiers
FT   CDS_pept        357537..357941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0422"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41052"
FT                   /db_xref="GOA:C4KDS9"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS9"
FT                   /protein_id="ACR41052.1"
FT                   /translation="MSYPGEFHKVLTLDDIYEGEAKLVEVNRYEILVVNINGEIKAYYA
FT                   RCAHALGLIEPNSFDGEEKIICPVHLWEYNARTGESINPEGSSLFPLDVKVEGNDIFVK
FT                   VPSIPVSEFKVKWFGMYRQRGVINEFGVNS"
     atgagttacc ctggagaatt ccataaagtg ctaacactag acgatattta tgaaggtgag        60
     gctaagttag tagaggtcaa tagatacgaa attctagtag tcaatataaa tggagaaata       120
     aaggcgtatt atgcaaggtg tgcccacgca ttaggtttaa tagagccaaa ttcttttgac       180
     ggtgaggaga aaatcatatg cccagtacat ttatgggagt ataatgcaag gacaggagag       240
     agcataaatc ctgagggaag ttccctcttt ccattggatg tgaaggttga aggtaatgac       300
     atttttgtta aagttccgtc tattcccgtt tccgagttca aggttaaatg gtttggtatg       360
     tataggcaaa gaggtgtgat aaatgagttt ggagttaact cttga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page