(data stored in ACNUC7421 zone)

EMBL: CP001402.PE419

CP001402.PE419       Location/Qualifiers
FT   CDS_pept        359407..359880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0425"
FT                   /product="protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41055"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT2"
FT                   /protein_id="ACR41055.1"
FT                   /translation="MKDKIVEILRQIYDPEIPINIYDLGLVREIKVEDNRVFVRLIFTA
FT                   NKGCTLADLMAVQVKYKLMKAFPDYNVEVKSDFNEEWNIGYATETGRLMLEEIYGKEAV
FT                   DALANKTKIEEIVSINKVRLEDFDPREYMKKAVDERYKRFKEWYDKHDILISH"
     atgaaagata agattgtgga aattttaagg caaatttacg atccagagat tccaataaat        60
     atatatgact taggactagt aagagagata aaagttgaag acaatagggt ttttgttaga       120
     ttaattttca ctgctaataa ggggtgtacc ttagcagatc ttatggcagt tcaagttaag       180
     tataaactaa tgaaggcgtt tccagactat aacgtggaag tcaagagtga ttttaacgaa       240
     gaatggaata taggctatgc aacagaaacg ggtaggctga tgttagagga aatatatgga       300
     aaagaagcag tggatgcgtt agctaataag actaaaatag aggaaatagt atcgataaat       360
     aaggtcaggt tagaggattt cgatccacgg gaatacatga aaaaagcagt ggatgagaga       420
     tataagagat ttaaggaatg gtacgataaa cacgatatat tgatttctca ttga             474
//

If you have problems or comments...

PBIL Back to PBIL home page