(data stored in ACNUC7421 zone)

EMBL: CP001402.PE420

CP001402.PE420       Location/Qualifiers
FT   CDS_pept        359946..361619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0426"
FT                   /product="thiamine pyrophosphate protein central region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41056"
FT                   /db_xref="GOA:C4KDT3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT3"
FT                   /protein_id="ACR41056.1"
FT                   /translation="MRVKSLIFMNGSKLLLTLLKDYDVKHIFGLPGESSISLYDQLKEG
FT                   EVLHIITRDERNAVYMADTYAKLTYKPGVVEGPSVGSIYMLPGVAEAYKSSTPLIVITT
FT                   DTPLYGEKENYLTALDQASLFRPITKETITVYNVEELPHAIRRAFRLSTSGKPGPVHIR
FT                   ILLDVLEDELKGNVELKAQKEFSKYPSQRPLADREMIRKAVDLILKSEFPVIICGQGAL
FT                   YSMAWDEVTELAELLGILVGTTITGKGCIPETHPLSIGVVGGRGGANFSNSIVDKSDLV
FT                   ILIGSNTDSANTYNWTIPSRGKTVIHIDISETETGNNYDSINLIGDAKVTLRELIKEIK
FT                   GSGKIDKKNIILDRSAFEDRLSKERREAVNPLRFIKELWSLSPEEAVLIADPGVSAIYT
FT                   AAFYKAKKVGRYFIFNYGLGGLGYSIPASVGAYFARPNSLIFSLSGDGSFGFSAGELET
FT                   IRRVNANVVIIIFNNGSYGWIRAEMKARGKDIVGTDFSSPDYVKIAEGYGLSAYGITND
FT                   EEISDTLKRAIKNTPSLVEVIVEPEDKFVPPVMPWSKRFL"
     atgcgtgtga aatcattaat attcatgaat ggttcaaaac ttctcttgac tctgttaaag        60
     gattatgacg ttaaacacat atttggttta ccgggcgaat cctcaatatc attatatgat       120
     caacttaaag aaggcgaagt actacacata atcactagag atgagagaaa cgcagtttac       180
     atggctgaca catacgcaaa gctaacttat aaacctggag ttgttgaagg cccaagtgtt       240
     ggttcaatat atatgctccc tggagttgct gaagcgtata agtcatctac accgttaata       300
     gtaataacta ctgatacacc gttatacgga gagaaggaga attatttgac cgcattagat       360
     caagcttccc tatttagacc gataactaag gaaactataa cagtgtataa tgttgaggaa       420
     ttacctcatg ctataaggag agcattcaga ttaagtacta gtggaaaacc tggaccagtt       480
     cacattagaa tactcctaga tgttttagaa gatgaattga aaggcaacgt tgaacttaaa       540
     gcccaaaagg agttctcgaa atatccatct caaagacctt tagcggatcg tgaaatgata       600
     aggaaagccg tagatttaat tttgaagagt gaatttccag taataatttg cggtcaagga       660
     gcactttact caatggcgtg ggatgaggta actgaattag ctgagttatt aggaattctt       720
     gtggggacta caataactgg taagggttgt attccagaaa cccatccctt gtcaataggt       780
     gtggttggcg gtaggggcgg tgcaaatttt tcgaacagta ttgtagataa atcagacctt       840
     gtaattctca taggaagtaa tacggattca gcaaatactt ataactggac tataccatcc       900
     agaggcaaaa ccgtaattca tattgacatt agcgagactg agactgggaa taattacgat       960
     agtataaacc tcatagggga tgctaaagta acattgaggg agttgattaa ggaaattaaa      1020
     ggtagtggaa aaattgataa aaagaacatt attttagata gaagtgcatt cgaagatagg      1080
     cttagtaagg agaggagaga agcagtaaac ccgttacgtt tcataaagga actttggagt      1140
     ctatcacctg aagaggctgt attaatagct gatcccggag ttagcgcaat ctacactgct      1200
     gctttctata aggccaaaaa agttggtagg tatttcattt ttaactatgg tctaggtggt      1260
     cttggctatt caattccagc atctgtaggt gcttattttg caaggcctaa ctctttgatt      1320
     ttctctcttt ctggagatgg gagtttcggt ttctcagctg gtgaactaga gaccataagg      1380
     agagtcaatg ctaatgtggt tattataatc tttaataatg gaagttacgg ttggataagg      1440
     gctgaaatga aagctagggg taaggacatt gttggaactg atttttcaag tccagattac      1500
     gttaagatcg ctgaagggta tggactatcc gcgtatggga taaccaatga tgaagagata      1560
     tctgatacgt taaagagggc tataaagaat actccttctt tagttgaggt tattgttgag      1620
     ccagaggata agttcgtccc tccggttatg ccttggagta agagatttct ttaa            1674
//

If you have problems or comments...

PBIL Back to PBIL home page