(data stored in ACNUC7421 zone)

EMBL: CP001402.PE426

CP001402.PE426       Location/Qualifiers
FT   CDS_pept        366382..367425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0432"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41062"
FT                   /db_xref="GOA:C4KDT9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT9"
FT                   /protein_id="ACR41062.1"
FT                   /translation="MRAVRLVEIGKPLVLKDIDIPKPKGAQVLIKVEAAGVCHSDVHMR
FT                   QGRFGNLRIVEDLGVKLPVTLGHEIAGKIEEMGDEVVGYSKGDLVAVNPWQGEGNCYYC
FT                   RIGEEHLCDSPRWLGINFDGAYAEYVLIPHYKYMYKLRRLNAVEASPLTCSGITTYRAV
FT                   RKASLDPTKTLVVVGAGGGLGTMAVQIAKAVGGATIIGVDVREEAVETAKRAGADYVIN
FT                   ASVQDPLAEIRRITEGKGIDAVIDLNNSEKTLSVYPKALAKQGKYIMVGLFGADLHFHA
FT                   PLITLSEIQFVGSLVGNQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAV
FT                   GRQVLIP"
     atgagagcag ttagattagt agaaatagga aaacctctcg ttttaaaaga tatagatata        60
     cctaaaccta agggagcaca agttttgata aaggtagagg ctgcgggagt ttgtcattct       120
     gatgttcaca tgagacaagg gagatttggg aatttaagaa tagtagaaga tttgggtgtg       180
     aaattgccgg taactttagg tcacgagatc gcaggaaaaa tagaggaaat gggagatgaa       240
     gttgttggat actctaaggg tgatctagtt gcagttaacc cttggcaggg agaaggaaat       300
     tgctattatt gtagaatagg ggaagagcat ttgtgcgatt ctcctagatg gttaggaatt       360
     aactttgatg gagcttacgc agaatatgtg ttaatacctc attataaata tatgtacaag       420
     ctgagaagac ttaatgccgt agaagcatca cctttaactt gttctggaat aactacatat       480
     agggcagtta gaaaagcatc attagaccca actaagacat tagtagtagt aggggctggt       540
     ggcggtctag gaacaatggc ggtacagata gctaaagctg tcggtggtgc aacgataata       600
     ggtgtagatg tgagagagga ggcagtagag actgctaaga gagctggagc cgattacgta       660
     ataaatgcgt cagttcaaga tcccttagcg gaaataagga gaataaccga aggtaaggga       720
     atcgacgctg taatagacct aaataactct gagaaaacgc tttcagttta tccaaaagct       780
     ttggcaaaac aaggtaagta cataatggtg ggattattcg gagcggattt gcattttcac       840
     gcaccattaa taactttgtc agaaatacaa ttcgtaggca gtttagttgg aaaccaatca       900
     gactttttgg ggataatgag attagcagag gctggtaaag ttaaaccaat gataactaag       960
     accatgaaac tagaagaggc aaatgaggcg attgataatc tagagaattt taaagctgtc      1020
     ggaagacaag tacttatacc ataa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page