(data stored in ACNUC7421 zone)

EMBL: CP001402.PE429

CP001402.PE429       Location/Qualifiers
FT   CDS_pept        complement(370899..371492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41065"
FT                   /db_xref="GOA:C4KDU2"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU2"
FT                   /protein_id="ACR41065.1"
FT                   /translation="MKKAELLFNAYKSRKEIEPFPLTEDEAKKVKEEFIEILINSEGLG
FT                   GYKLSGFGEGVLTKPMITRENMVELWFRNHKLEVEIVTLVENGEVKRTFLGLEIPAPRF
FT                   TTWDLPSHYIVADNIFAARLYVGPEIDPPFGSFKLYINDKFVGEGEPKYKPEEKVKEYM
FT                   KGYVSLGVFIGPTSVKKGDKIRVEGKKSISVSLI"
     atgaaaaaag ctgagttatt atttaacgca tacaagagta ggaaggagat agaaccgttt        60
     cccctaactg aagatgaggc taagaaggtt aaggaggaat ttatagagat tcttataaat       120
     agcgagggtt taggcgggta caaattatct ggtttcgggg aaggagtatt gacaaagcca       180
     atgataacca gagaaaatat ggtagaattg tggtttagaa atcacaaatt agaagttgag       240
     atagttaccc tagttgaaaa cggtgaagtt aaaaggacat tcctaggatt ggaaattcca       300
     gctccaaggt ttactacatg ggatctccct tcacattaca ttgttgcaga taatatcttt       360
     gcagctaggt tgtatgtagg accagaaatt gatcctcctt tcggttcatt taagctttat       420
     ataaacgata agttcgtagg agaaggtgag ccaaaatata agccagagga aaaggttaag       480
     gagtacatga agggttacgt ttccttggga gtatttattg gcccgactag cgttaaaaaa       540
     ggagataaga taagggtgga gggtaagaaa agtataagcg taagtctaat atga             594
//

If you have problems or comments...

PBIL Back to PBIL home page