(data stored in ACNUC7421 zone)

EMBL: CP001402.PE431

CP001402.PE431       Location/Qualifiers
FT   CDS_pept        complement(373641..374003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0437"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41067"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU4"
FT                   /protein_id="ACR41067.1"
FT                   /translation="MTKEKGWNRITELLKDSETLDLALVEVSNVIWKKVVLTNEITPQD
FT                   ANKAIMIIKEYLPQLLTVNKSVKLLERAIDISIMEKLTIYDSLYIALAESKRSKLLTSD
FT                   KKQYEVARKYVDSELF"
     gtgactaagg agaagggatg gaatagaatt acggagttac taaaggatag tgaaactcta        60
     gatctggcgc tagtagaagt ttccaatgtt atttggaaga aagtggtgtt aacaaacgag       120
     attactccac aggatgccaa taaggcgatt atgattatta aggaatatct acctcaattg       180
     ctgactgtaa ataaaagcgt taaactcttg gaaagagcta tagatatctc tataatggaa       240
     aaactgacta tatacgactc gctatatatt gccttagcgg aaagcaagag aagtaaatta       300
     ttaaccagcg ataaaaagca atatgaggtt gcaagaaaat acgtggactc ggaattattt       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page