(data stored in ACNUC7421 zone)

EMBL: CP001402.PE432

CP001402.PE432       Location/Qualifiers
FT   CDS_pept        complement(374026..374247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41068"
FT                   /db_xref="InterPro:IPR039709"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU5"
FT                   /protein_id="ACR41068.1"
FT                   /translation="MKMVYSLRIDKELREEMEKYDIKWNEEIEGFIRKRLEELKKEEIL
FT                   KRINEILSTMPETNSSSAEMVREDRDNN"
     atgaaaatgg tatacagttt aaggatagat aaagaattac gtgaggagat ggaaaagtac        60
     gacataaagt ggaatgaaga gatagagggt ttcataagga aaaggcttga ggaattgaaa       120
     aaagaggaga ttctaaagag gattaatgag atcctttcaa ccatgccgga aactaattca       180
     agtagtgcgg aaatggtgag ggaagatagg gataataatt ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page