(data stored in ACNUC7421 zone)

EMBL: CP001402.PE433

CP001402.PE433       Location/Qualifiers
FT   CDS_pept        375007..375117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU6"
FT                   /protein_id="ACR41069.1"
FT                   /translation="MTIKVKNKGHRKKDEKLLGYATNLNLSPKSIRRIML"
     gtgacaatta aggttaagaa caaggggcat aggaagaagg atgagaagct tttgggttat        60
     gctaccaatt tgaacttgtc tcctaagtcc attaggagga taatgttata a                111
//

If you have problems or comments...

PBIL Back to PBIL home page