(data stored in ACNUC7421 zone)

EMBL: CP001402.PE434

CP001402.PE434       Location/Qualifiers
FT   CDS_pept        complement(375528..376061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0440"
FT                   /product="Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41070"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU7"
FT                   /protein_id="ACR41070.1"
FT                   /translation="MYKNPYGLEIHLIKGDITEVEADAIVNAANSYLQHGGGVAYAIVK
FT                   KGGYVIQKESDEYVEKYGPVPVGEVAVTSAGKLKSKYVIHTVGPRYGIEGKDKLESAIF
FT                   KSLLKADELSLTSIALPAISTGIYGYPYEICARAMANILKNYKAKSLRKVIVCLYSQDA
FT                   YDIFKKVFDSILKS"
     atgtacaaga atccatacgg cctcgagatt catttaatta aaggtgatat aacggaagtg        60
     gaagctgatg caatagtcaa tgcagctaat tcttaccttc aacatggtgg aggagtagct       120
     tatgcaatag tcaaaaaggg aggttacgta attcagaaag agagtgacga atacgtcgaa       180
     aaatatggtc cggttccagt tggagaagtt gctgtaacta gtgcggggaa gttaaaatct       240
     aagtatgtta ttcatacagt gggcccaaga tatggaattg agggaaagga taagcttgaa       300
     tccgcaattt tcaaatcatt gttaaaggct gatgaacttt cgttaacctc aatagcctta       360
     cctgcaatct caactggaat ttacggctat ccatatgaga tatgcgctag agctatggca       420
     aatattctaa agaattacaa agctaagagt ttaagaaaag ttatagtctg cctttactct       480
     caagatgcat atgacatttt taagaaagtt tttgattcaa ttttgaaaag ctga             534
//

If you have problems or comments...

PBIL Back to PBIL home page