(data stored in ACNUC7421 zone)

EMBL: CP001402.PE436

CP001402.PE436       Location/Qualifiers
FT   CDS_pept        377366..377926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0442"
FT                   /product="LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41072"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU9"
FT                   /protein_id="ACR41072.1"
FT                   /translation="MQVLIVAPHPDDETLCCGGVVQIFKERGYKVSVVVVTDGRYGSPD
FT                   EKLKGSMELVEIRRQEALRASKILGIDEITFLSFEDSKVIEKEVEKALVEFLHDKDIVL
FT                   SPIPFDSHPDHAKIGKVMEKLYPKAYFYLIWGSMQANWREVRFDIRKYREVKIRAINEY
FT                   KSQIGGLHLDRFTGDYEVFWMKV"
     atgcaagttt tgatcgttgc gccccatcca gatgatgaga ctttgtgttg tggtggggtt        60
     gttcagattt ttaaagaaag gggttataag gtaagtgtcg ttgtagtaac tgacggaaga       120
     tacggttctc cagacgagaa attaaaagga agtatggagt tggttgagat taggagacaa       180
     gaggcattaa gggctagtaa gattttaggt atagatgaga ttacattctt gagtttcgag       240
     gactctaagg ttattgaaaa ggaagttgaa aaagcgttag tagagttttt acatgataaa       300
     gatatagtcc tttctccgat acccttcgat agtcatccag atcacgctaa aataggtaaa       360
     gtgatggaga agttatatcc aaaggcttat ttttacttaa tatggggttc tatgcaagct       420
     aattggagag aggttaggtt tgatattaga aagtatagag aggtcaagat tagggctata       480
     aatgagtata aaagtcagat tggtggtctt catttggata gattcactgg agactatgag       540
     gttttttgga tgaaggttta a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page