(data stored in ACNUC7421 zone)

EMBL: CP001402.PE437

CP001402.PE437       Location/Qualifiers
FT   CDS_pept        377930..378367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0443"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41073"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV0"
FT                   /protein_id="ACR41073.1"
FT                   /translation="MEFEVLYIADDVLYRTLGELLGNYVKTLLEKSGQGKRLSEQEYLI
FT                   LMNYYNSKNMDYVFTELRNIRNELRGIMEITDRKSKEAMDYTDKSRKEAMEYDEKNKKE
FT                   VIDYVDKTKKEILDYVDKRFEAINKRFEDLRELILTLAKEA"
     gtggaattcg aggttttata tattgcagat gacgtattgt ataggacttt gggagaatta        60
     ttaggcaatt acgttaaaac tttactagag aagagtggcc aaggaaagag gttgagtgag       120
     caggagtact tgattctaat gaattattat aatagtaaga atatggatta cgtatttaca       180
     gagttaagaa atattagaaa cgaattgaga ggtattatgg aaattacaga taggaaatct       240
     aaggaggcta tggattacac tgataaaagc agaaaggagg ctatggagta tgatgagaaa       300
     aataaaaagg aggtaataga ttacgtagac aagactaaga aggaaatatt ggattatgta       360
     gataagaggt ttgaggcaat taacaagaga tttgaagatt taagggaatt gattttaacg       420
     ttggctaagg aggcataa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page