(data stored in ACNUC7421 zone)

EMBL: CP001402.PE438

CP001402.PE438       Location/Qualifiers
FT   CDS_pept        complement(378372..379271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41074"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV1"
FT                   /protein_id="ACR41074.1"
FT                   /translation="MDESEIEKLYNGKLSDLYYLYSHATAEEIIKWMKNRKTAEIKIHE
FT                   IEGDSEVVVVIPTANVNGKLARNAKEVYKGFHIIFVESSGPLFNYARSVNLGVKHSLVL
FT                   KPKWVIISNDDVISIRGNIKEELSTVSINVDLIMASRSNYHTYPVVLVKPNDYFIKGMK
FT                   IFGMVFNLAPADVYGEILRYKERLGIKSITMIKSMVGFMVKFSGEIVGEFINSGSFAIV
FT                   RPREKVMDETFINSHEDLLLSITSKYYISKIKVREMRGASLGFGKLRFAKIFVNEIYFN
FT                   YLIRARVLKLNDKQLYSD"
     atggatgaaa gcgagataga gaagctatat aacggtaaat tgagtgatct ttattacctt        60
     tactctcatg ctactgcaga ggagataata aaatggatga aaaatcgtaa aacggcagag       120
     ataaaaatcc acgagataga gggagatagc gaagtagtag tggttatacc aactgctaac       180
     gttaatggga aattggcaag aaatgcaaag gaagtttata aggggtttca tataatattc       240
     gtagaaagct ctggcccctt attcaactac gctaggagtg ttaacttagg ggtaaagcat       300
     tccttagtgt taaagccgaa atgggttata atatcgaatg atgatgtgat aagcattagg       360
     gggaatataa aagaagagtt gagtacagtt tccataaacg tggatttgat tatggcttcg       420
     aggtctaatt atcatacata tcccgtggtt ttagtaaagc caaatgatta ctttataaag       480
     ggaatgaaaa ttttcggtat ggtatttaat ttagctcccg cagatgttta tggtgaaata       540
     ttacgttata aggaaaggct tggtataaag tcaattacga tgattaaatc catggttggt       600
     tttatggtaa agttctccgg ggaaattgtg ggcgaattca ttaactctgg cagtttcgca       660
     atagtaaggc ctagggaaaa agtaatggat gagacgttca ttaattccca tgaggattta       720
     ttgctttcaa ttacctcaaa atattacata agtaagatta aggtaaggga gatgagggga       780
     gcttcattgg gatttggaaa attgagattt gcaaaaatct tcgtgaatga aatctacttt       840
     aattatctaa ttagagccag agtattaaaa ttaaatgata agcaactata tagtgattag       900
//

If you have problems or comments...

PBIL Back to PBIL home page