(data stored in ACNUC7421 zone)

EMBL: CP001402.PE44

CP001402.PE44        Location/Qualifiers
FT   CDS_pept        complement(37648..38223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40680"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJG0"
FT                   /protein_id="ACR40680.1"
FT                   /translation="MPRVNIAAEADLIEQLESEAKKRGYTIYSLTNAALKALLKLLKEG
FT                   EDANTLESLVDYYTISKALDIVPVTSWFLENLTKLAYEKDSKQYENMCEEVGEQIGSFL
FT                   RSKASTLDELFDFYNAIKIILPIRNVAIKNAGDVIEFRITGTGFSLISTLCAGKIFSKI
FT                   AEAYDLSIQDVDVVPGGIVTIKAKANLK"
     atgccaagag ttaatatagc agctgaagct gacctaatag agcaattgga aagcgaggca        60
     aaaaagaggg gttataccat ttattctttg actaacgctg ctcttaaggc cttactgaaa       120
     cttttaaagg agggtgaaga cgcaaataca ttagaaagtt tagtggatta ttatacaata       180
     tcaaaggcat tagatatagt tccggtaacg agttggttcc ttgagaattt aaccaaatta       240
     gcttatgaaa aagacagtaa gcagtatgaa aatatgtgtg aagaagtagg agagcaaata       300
     gggtcattct tgagatcaaa agcctcaacg ctagatgaat tatttgattt ttataatgca       360
     attaaaatta tcttgcccat aagaaatgta gcaattaaaa atgctggtga tgtaatagaa       420
     tttagaataa ctggaaccgg atttagttta atctctacct tatgtgcagg aaagatattc       480
     tcaaaaatcg cagaggcata tgatttgtca atacaagatg tagatgtggt accaggtgga       540
     atagttacta tcaaagctaa ggccaaccta aaatag                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page