(data stored in ACNUC7421 zone)

EMBL: CP001402.PE445

CP001402.PE445       Location/Qualifiers
FT   CDS_pept        384819..385232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0451"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41081"
FT                   /db_xref="GOA:C4KDV8"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV8"
FT                   /protein_id="ACR41081.1"
FT                   /translation="MLDASTRGQILEFILNDRNQRSTAYLFITHDISIASYVSDRIGVM
FT                   YLGKLVEIGSPEEVISEPLHPYTQALLQAVPVPDPDVGVREPNIKGEIQNPLELPKGCV
FT                   FYNRCPFAKDICKEKPPEIKRIKGDHYVACHLY"
     atgcttgatg catcaactag aggccaaatt ttggagttta tattgaacga taggaatcaa        60
     aggagtacag cttacttatt tataacccat gatatctcaa tagccagtta cgtgtcagat       120
     agaatcggag taatgtattt aggaaaatta gttgagattg gatcccctga agaagtgata       180
     agtgaaccac tacatcccta tacgcaagca ctattacaag ctgttcctgt cccagatcca       240
     gatgttggtg taagggagcc taatatcaag ggtgaaattc aaaatcctct tgaattacca       300
     aagggatgcg tattctataa tagatgcccg ttcgcaaaag atatttgcaa ggaaaaaccc       360
     ccagagataa agaggataaa gggagatcat tatgtcgcat gccatctata ctaa             414
//

If you have problems or comments...

PBIL Back to PBIL home page