(data stored in ACNUC7421 zone)

EMBL: CP001402.PE453

CP001402.PE453       Location/Qualifiers
FT   CDS_pept        complement(390737..391783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0459"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41089"
FT                   /db_xref="GOA:C4KDW6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW6"
FT                   /protein_id="ACR41089.1"
FT                   /translation="MGFTTYMIKKVLIYFSVLLATLTILYIFTFPILQEVIAKSINFQV
FT                   AQFSQTLFKNAHNLNSTQIQIAVEKYRESLIAAYGLNQPIIDKYFIQMYNLMRFDFGTA
FT                   YFLQAPSGSREVSSIIAYYLPNTILLFTTATIVFIVAGTIIGLLSAKSKFWEKVIAIIA
FT                   VIHSSIPTWWLGFVLIAALAYAVKVFPPGGMTSVPPPKNPFDYGISVLYHMSLPLITIF
FT                   IVNVGGFAYIVRSLVTSIMKEDFVITAKARGLPDSRILYRHVLRSASPSIATQAILALA
FT                   GSLGGSLTTEVVFEWPGVGLLTYVAITLNDLPVILGITYVLTIVLLLGLFLGELVYGLL
FT                   DPRIKVGE"
     atgggtttta ccacatatat gataaaaaag gtacttattt atttttcagt tcttctagcc        60
     actttaacca ttctttatat ttttactttt cccatattgc aggaggttat agctaagagt       120
     atcaattttc aagttgcaca gttctctcaa actttgttta aaaatgccca taatctaaac       180
     tctactcaaa ttcagattgc agtagagaag tatagggaat ctttaattgc ggcttacggg       240
     cttaaccaac caattatcga taaatatttt atccaaatgt ataatttgat gcgtttcgat       300
     ttcggtacag cttacttttt acaagctcct tctggttcta gagaggttag ttcaattata       360
     gcttattatt tgcccaatac tattctctta tttactactg ctactatagt attcatagta       420
     gctgggacta taattggctt actctctgca aaatctaaat tctgggagaa ggtaattgca       480
     ataatagctg taatacactc tagtattccc acttggtggt tgggttttgt cctaattgct       540
     gctttagcat atgcagttaa agttttccca cctggaggaa tgacctcagt tccaccgcca       600
     aagaatccat ttgattatgg aataagtgtt ttatatcata tgtcattacc attgattact       660
     atatttattg taaacgtcgg aggattcgca tacattgtta gaagtttagt tacatcaatt       720
     atgaaggaag attttgtgat tacagcgaag gctagaggat taccagattc cagaatattg       780
     tatagacatg tcttacgctc tgcctcccca tcaattgcca cacaagctat tttagcacta       840
     gctggatcat taggaggtag tttaaccaca gaggttgttt tcgaatggcc tggggtaggt       900
     ttgttaactt atgttgccat aaccttaaat gatttaccag tgatattagg gataacctac       960
     gttttgacaa ttgtgttgct acttggattg tttttagggg aattagttta cggattattg      1020
     gatcctagaa taaaggtagg tgaataa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page